PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim07g049640.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 105aa    MW: 12211.2 Da    PI: 7.5594
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim07g049640.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like80.81.6e-252373151
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51
                        kpr rWt eLHe Fv+av++LGG+  AtPk+i++lm+ +++t eh+kSHLQ
  Sopim07g049640.0.1 23 KPRFRWTVELHEMFVKAVNELGGPYDATPKNIVKLMDDEDITPEHIKSHLQ 73
                        79************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.3E-232273IPR009057Homeodomain-like
SuperFamilySSF466893.4E-142274IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-202374IPR006447Myb domain, plants
PfamPF002495.9E-72773IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 105 aa     Download sequence    Send to blast
MTEGSSKKQR CDRVVASHDL NRKPRFRWTV ELHEMFVKAV NELGGPYDAT PKNIVKLMDD  60
EDITPEHIKS HLQVSKPLYA CVFSFLFLSI RFLRLIDYME HECI*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755194e-92HG975519.1 Solanum lycopersicum chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010324098.14e-50PREDICTED: protein PHR1-LIKE 1-like
RefseqXP_015081511.13e-50PREDICTED: protein PHR1-LIKE 1-like
TrEMBLK4CF653e-74K4CF65_SOLLC; Uncharacterized protein
STRINGSolyc07g049640.2.19e-74(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA120621623
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.44e-17G2-like family protein